PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_9560_f_5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family LFY
Protein Properties Length: 410aa    MW: 46188.1 Da    PI: 8.1335
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_9560_f_5genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY612.96.1e-18713911386
        FLO_LFY   1 mdpeafsaslfkwdpraaaaapparlleeaavseapleaaaaaaark..lreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmksls 94 
                    mdpeaf+aslfkwdpr ++ +pp+r+le  a+++apl++a    ar   l +leelf++yGvry+t+++iaelGftv+tL+dm+deeld++++sl 
  Neem_9560_f_5   1 MDPEAFTASLFKWDPRGVV-QPPTRVLEPVAQPPAPLATAGFPVARPrdLGGLEELFQDYGVRYYTASRIAELGFTVNTLLDMRDEELDEMINSLG 95 
                    9***************887.5667888999888888655554444433488********************************************* PP

        FLO_LFY  95 eifrldllvGeryGikaavraerrrleeeeaekkrrkllsedeetaldalsqeglseepvqeekeaags............ggeglgeaelvaaee 178
                    ++fr++llvGer+Gikaavraerrr eee+   +rr+lls d+++a+dalsqe+l ++ ++  + ++                  ++e+e++++  
  Neem_9560_f_5  96 QVFRWELLVGERFGIKAAVRAERRRHEEED--LRRRHLLSGDTTNAVDALSQEVLDKKGKRAPTPRNIDlntrflglseepV---QQEKEAAGSGG 186
                    ****************************88..89999****************77766655533222222233444432211...12222222221 PP

        FLO_LFY 179 .kkseeekkkaskkkqkrkkkkelkseededeeeeededeegsgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiaker 273
                        +    k ++k+q+r+k ++  +  d +   ee++++++ g +g erqrehPfivtepgevargkknGLDYLf+LyeqCr+fL+qvq+iaker
  Neem_9560_f_5 187 gGPWDVAGVKVERKQQRRRKGQR--KVVDVNL--EEENEDDEYGGGGIERQREHPFIVTEPGEVARGKKNGLDYLFHLYEQCRDFLVQVQNIAKER 278
                    12222233333332233333222..3344444..44445556677799************************************************ PP

        FLO_LFY 274 GekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprLsiWY 369
                    GekcPtkvtnqvfryak+agasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdida+fnahprLsiWY
  Neem_9560_f_5 279 GEKCPTKVTNQVFRYAKRAGASYINKPKMRHYVHCYALHCLDEEASNALRRAFKERGENVGAWRQACYKPLVAIAARQGWDIDAIFNAHPRLSIWY 374
                    ************************************************************************************************ PP

        FLO_LFY 370 vPtkLrqLChlerskas 386
                    vPt+LrqLCh+er++a+
  Neem_9560_f_5 375 VPTRLRQLCHAERNSAT 391
                    *************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016981.1E-1981390IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 410 aa     Download sequence    Send to blast
MDPEAFTASL FKWDPRGVVQ PPTRVLEPVA QPPAPLATAG FPVARPRDLG GLEELFQDYG  60
VRYYTASRIA ELGFTVNTLL DMRDEELDEM INSLGQVFRW ELLVGERFGI KAAVRAERRR  120
HEEEDLRRRH LLSGDTTNAV DALSQEVLDK KGKRAPTPRN IDLNTRFLGL SEEPVQQEKE  180
AAGSGGGGPW DVAGVKVERK QQRRRKGQRK VVDVNLEEEN EDDEYGGGGI ERQREHPFIV  240
TEPGEVARGK KNGLDYLFHL YEQCRDFLVQ VQNIAKERGE KCPTKVTNQV FRYAKRAGAS  300
YINKPKMRHY VHCYALHCLD EEASNALRRA FKERGENVGA WRQACYKPLV AIAARQGWDI  360
DAIFNAHPRL SIWYVPTRLR QLCHAERNSA TAAAAAASSS VSGGGEHLPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1112294102194PROTEIN LEAFY
2vy2_A1e-1112294102194PROTEIN LEAFY
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY9708231e-113AY970823.1 Poncirus trifoliata isolate CTRSLFY LFY-like gene, complete sequence.
GenBankDQ9953471e-113DQ995347.1 Citrus unshiu LEAFY (LFY) gene, complete cds.
GenBankDQ9953481e-113DQ995348.1 Citrus maxima LEAFY (LFY) gene, complete cds.
GenBankDQ9953491e-113DQ995349.1 Citrus reticulata LEAFY (LFY) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006436969.10.0hypothetical protein CICLE_v10033942mg
RefseqXP_006485166.10.0PREDICTED: floricaula/leafy homolog
SwissprotO040640.0FLLH_POPTR; Floricaula/leafy homolog
TrEMBLM1LEY10.0M1LEY1_9R
STRINGPOPTR_0015s11820.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79072841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-108floral meristem identity control protein LEAFY (LFY)